General Information

  • ID:  hor007298
  • Uniprot ID:  Q9W4Q9??33-159)
  • Protein name:  Probable insulin-like peptide 7
  • Gene name:  NA
  • Organism:  Drosophila melanogaster
  • Family:  Insulin family
  • Source:  Human
  • Expression:  Broadly expressed at a low level throughout the embryo; except the yolk. Expressed at a moderate level in the embryonic midgut. Larval expression is restricted to ten cells of the ventral nerve cord -
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Eremoneura; Cyclorrhapha; Schizophora; Acalyptratae; Ephydroidea; Drosophilidae (pomace flies); Drosophilinae; Drosophilini; Drosophila (fruit flies); Sophophora; melanogaster group; melanogaster subgroup; Drosophila melanogaster (Fruit fly)
  • GO MF:  GO:0005576 extracellular region; GO:0005615 extracellular space
  • GO BP:  GO:0005158 insulin receptor binding
  • GO CC:  GO:0008286 insulin receptor signaling pathway

Sequence Information

  • Sequence:  QHTEEGLEMLFRERSQSDWENVWHQETHSRCRDKLVRQLYWACEKDIYRLTRRNKKRTGNDEAWIKKTTTEPDGSTWLHVNYANMFLRSRRSDGNTPSISNECCTKAGCTWEEYAEYCPSNKRRNHY
  • Length:  127
  • Propeptide:  MTRMIIQNSGSWTLCGAVLLFVLPLIPTPEALQHTEEGLEMLFRERSQSDWENVWHQETHSRCRDKLVRQLYWACEKDIYRLTRRNKKRTGNDEAWIKKTTTEPDGSTWLHVNYANMFLRSRRSDGNTPSISNECCTKAGCTWEEYAEYCPSNKRRNHY
  • Signal peptide:  MTRMIIQNSGSWTLCGAVLLFVLPLIPTPEA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA